SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3L4Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3L4Y1
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000000101
Family DBL homology domain (DH-domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3L4Y1
Sequence length 129
Comment (tr|I3L4Y1|I3L4Y1_HUMAN) Active breakpoint cluster region-related protein {ECO:0000313|Ensembl:ENSP00000461629} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ABR OC=Catarrhini; Hominidae; Homo.
Sequence
MPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIY
INQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDS
QVTMGHLFQ
Download sequence
Identical sequences A0A2J8JKK7 A0A2J8SNQ9 I3L4Y1
ENSP00000461629 ENSP00000461629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]