SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3MIW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MIW5
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-54
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 614-869
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-54
Family YWTD domain 0.00000608
Further Details:      
 
Domain Number 3 Region: 313-543
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-50
Family YWTD domain 0.00000255
Further Details:      
 
Domain Number 4 Region: 915-1116
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-28
Family YWTD domain 0.00022
Further Details:      
 
Domain Number 5 Region: 1236-1272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1157-1197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1198-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 569-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 872-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 267-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000027
Family EGF-type module 0.008
Further Details:      
 
Domain Number 11 Region: 1116-1167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000791
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3MIW5
Sequence length 1516
Comment (tr|I3MIW5|I3MIW5_ICTTR) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSSTOP00000011017} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=LRP5 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
SPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTY
LNHSGAATQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLD
QPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW
ADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKR
KEILSALYSPMDIQVLSQERQPSFHTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQE
DGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGHVYWTD
DEVRAIRRAYLDGSGAQTLVSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRK
ILVSEDLDEPRAIVLHPVMGLMYWTDWGESPKIECAHLDGRERRVLVNTSLGWPNGLALD
LQEGKLYWGDAKTDKIEVINVDGTERRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERV
HKVKASRDVIIDQLPDLMGLKAVNVAKVIGTNPCAEGNGGCSHLCFFTPRATKCGCPIGL
ELLSDMRTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLAGVKEASALDFDVSNNHIYW
TDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQF
RQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNGMTLVDKVGRANDLTI
DYADQRLYWTDLDTNMIESSNMLGQDRVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERA
DKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASH
YTLDPSSRNCSPPSAFLLFSQKCAISRMIPDDQRSPDLILPLHGLRNVKAIDYDPLDKFI
YWVDGRQNIKRAKDDGTQPFVLTSPGQSQNLSPDRQPHDLSIDIYSRMLFWTCEATNTIN
VHRLDGDAMGVVLRGERDRPRAIAVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTT
GLIRPVALVVDNTLGRLFWVDADLKRIESCDLSAAHPCARDNGGCSHICIAKGDGTPRCS
CPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDELGCPVCS
AAQFPCARGQCVDLRLRCDGEADCQDRSDEAHCDAICLPNQFRCASGQCVLIKQQCDSFP
DCMDGSDELMCEITKPPSDDTPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGAS
GPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGISCSKSMMSSVSLMGGRSGPPLYDRNHVT
GASSSSSSSTKATLYPPILNPPPSPATDPSLCNMDMFYSSNIPATARPYRPYIIRGMAPP
ATPCSTDVCDSDYSTSRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERS
YCHLFPPPPSPCTDSS
Download sequence
Identical sequences I3MIW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]