SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3MPK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3MPK9
Domain Number 1 Region: 559-814
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 258-504
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-49
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 3 Region: 862-1121
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-39
Family YWTD domain 0.0000458
Further Details:      
 
Domain Number 4 Region: 15-121,151-207
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000000719
Family YWTD domain 0.0015
Further Details:      
 
Domain Number 5 Region: 816-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1252-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 514-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000011
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1173-1213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1214-1250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 210-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1131-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000306
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3MPK9
Sequence length 1540
Comment (tr|I3MPK9|I3MPK9_ICTTR) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=LRP6 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
LACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWS
DVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLAFFVYCSKVIHCISFSWFLLSHTPHYHF
NGSEDVMIKEEKLKVSFSFCINRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKY
TGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTG
VKLLENGKTCKNGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGY
IYWTDDEVRAIRRSFIDGSSSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN
GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVMVNTSLGWPN
GLALDYDESKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRR
SIERVHKRSADREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCA
CPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTD
NRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSK
LDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRA
NGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRR
SIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFV
CGCPAHYSLNSDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYD
PLDKQLYWIDSRQNVIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCE
ATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTER
EVLFFSGLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVF
ENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGG
CSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGF
TECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRC
ANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFI
CQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMG
GSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHR
SYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTP
RSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences I3MPK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]