SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3N2Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3N2Q2
Domain Number 1 Region: 16-131
Classification Level Classification E-value
Superfamily POZ domain 1.29e-29
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 401-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000115
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 370-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000212
Family Classic zinc finger, C2H2 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3N2Q2
Sequence length 474
Comment (tr|I3N2Q2|I3N2Q2_ICTTR) Zinc finger and BTB domain containing 43 {ECO:0000313|Ensembl:ENSSTOP00000018648} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=ZBTB43 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
LNKICDEMEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAA
SSPYFCDQVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMW
HVVDKCTEVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGSHTDFPKAQELRD
GENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYS
KPSIMAHKRWIHVKPERLEQACEGMDVHAAYDEHQVTESINTMQTEHSVQPSGVEEDFPI
GEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEM
VTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKH
HLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN
Download sequence
Identical sequences I3N2Q2
ENSSTOP00000018648 ENSSTOP00000018648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]