SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3TFH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3TFH2
Domain Number 1 Region: 4-175
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.73e-53
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 182-288
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.44e-24
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3TFH2
Sequence length 291
Comment (tr|I3TFH2|I3TFH2_THEC1) Molybdopterin dehydrogenase FAD-binding protein {ECO:0000313|EMBL:AFK51510.1} KW=Complete proteome; Reference proteome OX=1184251 OS=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633). GN=TCELL_1087 OC=Desulfurococcaceae; Thermogladius.
Sequence
MFYKLPSFEYYRAGSVEEAVELASKLGDYKFLAGGTDLLVDLKIGRYRPRAVIDLGGLRE
LRYVVDEGSKVRIGALTTLEEILRSDVVKEKLPLLHQAVYNMASWQIRSVATIGGNIANA
SPAADTAPPLLVHDAVVKLRSPGGSRSINLGEFVLGPRKTAMETGEMIAEFEVPVVEGLS
EYWAYRKFGRRSAFTLSVVGLALGVEVRPGGELRFRVALNSVAPRPVRAVTVEAYLNEKG
LSDESIETASRLVQQDISPITDVRATAEYRRHLASTLLKDALREVAGKLRR
Download sequence
Identical sequences I3TFH2
gi|389861408|ref|YP_006363648.1| WP_014737760.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]