SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3XQR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XQR5
Domain Number 1 Region: 2-171
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.47e-36
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00085
Further Details:      
 
Domain Number 2 Region: 180-286
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 3.92e-16
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3XQR5
Sequence length 293
Comment (tr|I3XQR5|I3XQR5_DESAM) Molybdopterin dehydrogenase FAD-binding protein {ECO:0000313|EMBL:AFL66289.1} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_0379 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MFDIHRPRDLSDALQFLDKYSPDAKPLAGGTELLVLIRDRKIPVPKYLVDLSPLRRDLSY
VVVENGMVRIGALTTLWEISKSILHQDIKYAGFIDAFRKFGTMAIRFNATIGGNIASATQ
YSDYITLLLVYDAELRLESVHGVRKVRLEEFLVDKRKTILMPNEIITEISFKEPPSKTSS
AFIKFDRRELLIAGIVTGAIYLTEEEGRIREARIAFDMISEHRIPGRARSTEKCITGRNI
SEETLIEAEQCLEKEMKRISDWWATSEYRLEMSKAILRKGLRLVHNRILNGVM
Download sequence
Identical sequences I3XQR5
gi|390938126|ref|YP_006401864.1| WP_014767190.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]