SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3XRV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XRV0
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Flavoproteins 3.97e-17
Family NADPH-dependent FMN reductase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3XRV0
Sequence length 153
Comment (tr|I3XRV0|I3XRV0_DESAM) Flavodoxin {ECO:0000313|EMBL:AFL66674.1} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_0777 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MIIYVSIHHGNTEKIAKAISSILGARLVKPWEIQPDEVVEYKLAGFGSGIYYWRHHTALI
RLAEKLPPAPGKMAFIFSTAGIPLKMINHRALKKILVGKRYRLIGEFTCRGWDTNGVLAR
IGGLNKGHPNEKDLEKAVKFALRLKRILEEKNN
Download sequence
Identical sequences I3XRV0
gi|390938511|ref|YP_006402249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]