SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3YKC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3YKC6
Domain Number - Region: 366-483
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0034
Family Fucose binding lectin 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3YKC6
Sequence length 506
Comment (tr|I3YKC6|I3YKC6_ALIFI) Uncharacterized protein {ECO:0000313|EMBL:AFL77444.1} KW=Complete proteome OX=679935 OS=46020 / CIP 107999). GN=Alfi_1090 OC=Alistipes.
Sequence
MKAMMMKKQNVGNACGWAGRLARLLLLPALTLVLLCSCDEDKAKSERPEEGDQLWKIVPV
LASESDGFEGLGEYGVSLYLFNDMSSDCYKYQHADSFGDLEPFVVEKAAYSLVALMMDRD
VPHVFYEASDEAKKNTTVTVTDMNETIPDMVLGTASVSRNVGATVPVSDLQRLVGALDVR
LTDVPNDVTAVELTVGDLYDRVDLTGQYDFSTGEPASKRIELTKEGTVFSARSVLMPSDE
TRANVKMDFRVFRGDAYEDFVVRLSGSIPADKLTRLEGRAEEILKNAELTLGLTYAPWDA
SITIEDHFQTDDDLNKVWSSAPLPISGAADPGYDNFWASSVFTDWDGSVKYDSYLYDGIM
DGSDEHKDLYWGPDAVGEAEKGTVPSWYVDLGTGCQGITLTYWNKFGGKGGQKLRTMNIY
GSNAPEDYRGGNESWTLITTFTSDRTKPTEDAGAEVTTGRIEFDKGNATYRYVKCEITSR
VNADGNVVEDSDVNVAEVQITVWSCK
Download sequence
Identical sequences I3YKC6
WP_014775067.1.56960 gi|390946369|ref|YP_006410129.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]