SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3YPR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3YPR8
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Flavoproteins 0.0000000000000034
Family Hypothetical protein YwqN 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3YPR8
Sequence length 88
Comment (tr|I3YPR8|I3YPR8_ALIFI) NADPH-dependent FMN reductase {ECO:0000313|EMBL:AFL78986.1} KW=Complete proteome OX=679935 OS=46020 / CIP 107999). GN=Alfi_2727 OC=Alistipes.
Sequence
MKVLVLNGSPRRNGLVSQMLEHIAGSLPETCDVERIFVHDLTVRPCTGCMSCRSKLRCAL
PEDDAHRVAEEIRTAEIEKCKKLARKIC
Download sequence
Identical sequences I3YPR8
gi|390947911|ref|YP_006411671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]