SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3YR20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3YR20
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Flavoproteins 4.68e-44
Family Flavodoxin-related 0.000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3YR20
Sequence length 163
Comment (tr|I3YR20|I3YR20_ALIFI) Flavodoxin {ECO:0000256|PIRNR:PIRNR038996} KW=Complete proteome OX=679935 OS=46020 / CIP 107999). GN=Alfi_3205 OC=Alistipes.
Sequence
MTGIFFGSTMGTTEAVAADIAKQLGVADADVHNVADTPAGEVQKYDLLVLGSSTWGAGEL
QDDWYGFLDQLKAQDLSGKKVALFGCGDSGSYPDTFCDAVGLIYDGLQQSGCTFVGAYAP
EGYDETGSLVCRGGKFVGLAVDESAPDKTDRRVAAWCEQIKNE
Download sequence
Identical sequences A0A173Y490 E4MBS9 I3YR20
gi|390948363|ref|YP_006412123.1| WP_009597720.1.14540 WP_009597720.1.48748 WP_009597720.1.56960 WP_009597720.1.76885 WP_009597720.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]