SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3YR44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3YR44
Domain Number 1 Region: 27-152
Classification Level Classification E-value
Superfamily Flavoproteins 6.42e-22
Family Flavodoxin-related 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3YR44
Sequence length 185
Comment (tr|I3YR44|I3YR44_ALIFI) Flavodoxin {ECO:0000313|EMBL:AFL79462.1} KW=Complete proteome OX=679935 OS=46020 / CIP 107999). GN=Alfi_3234 OC=Alistipes.
Sequence
MKRIVLIAIMTMFLPDMNTQAQTASGTKVLVAYFSHSGNTRAMARQIAEATGGDLFEIVP
AAAYPAEYGAVVDQAKKEIGGGVRPALKGRLPDVGAYDVIFVGSPCWWSTVAPPVATFLA
DCDWAGKTVVPFMTHEGSRMGRSEEDIRKLCAGATLLGGLPLRGGAVKDSRDVVRKWVQG
LNLTK
Download sequence
Identical sequences E4MCW6 I3YR44 R5UFI3
gi|390948387|ref|YP_006412147.1| WP_009598160.1.56960 WP_009598160.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]