SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4AK31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4AK31
Domain Number 1 Region: 2-357
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.14e-65
Family Cystathionine synthase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I4AK31
Sequence length 360
Comment (tr|I4AK31|I4AK31_BERLS) Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase {ECO:0000313|EMBL:AFM04316.1} KW=Complete proteome; Reference proteome OX=880071 OS=NCIMB 1366 / Sio-4) (Flexibacter litoralis). GN=Fleli_1926 OC=Bernardetia.
Sequence
MKIYLTPGPSENYFVVEEAIKEALQKKITAISHRSKEFKAIFGNTTNQLRELLEIPADFS
IAFTGSANEIWERILQSCVEKESFHLINGSFSKKFYHFAKQLNLNPSKYEVDFSKGFGVE
NINVPNSAELIAVIQNETSSGVQFPIENIAKIREKNKEKLIVVDAVSSLPYANLDFSIID
SVYFSVQKGFGVPAGLGVWIYNQKMVDKAKSLQEKGKSTGTYHSLLELDKYAQNNQTPET
PNVLEIFVLGKVIEAMNKKGIAMIRRETDYKAELLYHTLEQSEFLSPLITEKSQRSKTVI
VANVEKGTSSDVIAFLEKKGIIIGKGYGSFKDSQIRIANFPTHSKELMEQVADFLMEYGK
Download sequence
Identical sequences I4AK31
WP_014797767.1.630 gi|392397508|ref|YP_006434109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]