SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4B1E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4B1E7
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.4e-65
Family Methylesterase CheB, C-terminal domain 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4B1E7
Sequence length 200
Comment (tr|I4B1E7|I4B1E7_TURPD) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=869212 OS=(Leptospira parva). GN=Turpa_0448 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Turneriella.
Sequence
MNALYHHASKLVAIGASAGGPHAIETVLGELGADMPPILITQHMPEVFTRAFARRLDEIM
ALTVVEADATEKLKSGTVYIAPGDRHLIVRRQGLELFATTDAGPPVNRHRPSVDVLFESV
VSAAPASAMGIILTGMGNDGARGLAAMRHAGFLTIAQDEATSVVWGMPREAVKLEAVDGS
HILPLSKIGPAIKNFVKLPI
Download sequence
Identical sequences I4B1E7
WP_014801624.1.12531 gi|392401998|ref|YP_006438610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]