SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4B1K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4B1K0
Domain Number 1 Region: 2-190
Classification Level Classification E-value
Superfamily SIS domain 3.59e-54
Family mono-SIS domain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4B1K0
Sequence length 196
Comment (tr|I4B1K0|I4B1K0_TURPD) Sedoheptulose 7-phosphate isomerase {ECO:0000256|HAMAP-Rule:MF_00067} KW=Complete proteome; Reference proteome OX=869212 OS=(Leptospira parva). GN=Turpa_0503 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Turneriella.
Sequence
MKDYIRAQVKDSISVKERYLADEANINQLDKICADVIAAYKAGKKTLIAGNGGSAADAQH
IAAEFVSRFYFDRPALASIALTTDTSALTAIGNDYGYELLFSRQLEANAQPGDIYIAIST
SGNSKNVLHSLEVAKKIGLKTIGLTGMKGGKMADMVDYCVRVPSDETPRIQECHILIGHI
LCAAVEKELFEKEYRK
Download sequence
Identical sequences I4B1K0
gi|392402051|ref|YP_006438663.1| WP_014801677.1.12531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]