SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4B7E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4B7E7
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.44e-33
Family Ribosomal protein L6 0.0000815
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.23e-20
Family Ribosomal protein L6 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4B7E7
Sequence length 180
Comment (tr|I4B7E7|I4B7E7_TURPD) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome; Reference proteome OX=869212 OS=(Leptospira parva). GN=Turpa_2564 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Turneriella.
Sequence
MSRIGNKPIELPAGVSLTAADGSVTVKGPKGSLVTPFFPGLKLEVSGTTAKVSRENDEKD
LRAKHGLVRSLLQNCVTGTSAGYTQLLILQGVGYRAQKKGKDVVFSLGFSHDVIFKEPAD
VSVEVVENTKVKISGVDKQRVGQVAAQIRAYKQPEPYKGKGIRYENEHVRRKAGKAGSKK
Download sequence
Identical sequences I4B7E7
WP_014803709.1.12531 gi|392404098|ref|YP_006440710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]