SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4B8W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4B8W1
Domain Number 1 Region: 52-407
Classification Level Classification E-value
Superfamily SIS domain 7.37e-71
Family Phosphoglucose isomerase, PGI 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4B8W1
Sequence length 416
Comment (tr|I4B8W1|I4B8W1_TURPD) Glucose-6-phosphate isomerase {ECO:0000256|RuleBase:RU000612, ECO:0000256|SAAS:SAAS00846232} KW=Complete proteome; Reference proteome OX=869212 OS=(Leptospira parva). GN=Turpa_3079 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Turneriella.
Sequence
MSHEVRFSANKFWMNWQSMGRAQELDALMHAGFRKWPAAFSTDYMKTSELAPLEKWAAEL
RQLDAQTLIVIGIGGSSLGGIALKALIDAHSDRLIFWEGPHPSKMQKIAQIAEQKQTAVL
VVSKSGTTLETRANLSLFRQFFPGVPEYFVTSEPAAIKDLGANSKNTFLIPKDLGGRFSI
VSPVGMMPAMFVDYNVKAFLTAFDEANAEWEISIPVAENVAKQTAIHFYNLFAARFTGVA
FWVYAADLVDWGRWLVQLWAESLGKKPHIAALPMIVQGPEDQHSLLQYFMEASNRHLHCF
VHTQSYGSRDSLISSEIRGDFADKSMSQILNAQMKSIESALSAKERPVAEYMLSDLSETE
MARWFCFWMHVVSYLGYLWEINPFDQPGVEAGKIICKKLLRGENVEEAVQPVFDLR
Download sequence
Identical sequences I4B8W1
gi|392404612|ref|YP_006441224.1| WP_014804219.1.12531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]