SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4FPV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4FPV1
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily L21p-like 5.89e-36
Family Ribosomal protein L21p 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4FPV1
Sequence length 129
Comment (tr|I4FPV1|I4FPV1_MICAE) 50S ribosomal protein L21 {ECO:0000256|HAMAP-Rule:MF_01363, ECO:0000256|RuleBase:RU000562, ECO:0000256|SAAS:SAAS00352960} KW=Complete proteome OX=1160286 OS=Microcystis aeruginosa PCC 9717. GN=MICAB_3620003 OC=Microcystaceae; Microcystis.
Sequence
MSYAIIETGGKQIRVEPGRYYDIELLPVDEQSTHTIDKVLLIHDEDDISIGQPFIEGATV
EGTVIQHRRGKKVIVYKMRPKKKTRKKRGHRQEITRFMIDSINYNGKTLVATAATSSAEV
VEDSSDEEE
Download sequence
Identical sequences A0A139GQU5 A0A1V4BY04 B0JQG4 I4FPV1
WP_002760284.1.24258 WP_002760284.1.4043 WP_002760284.1.52201 WP_002760284.1.79847 gi|166363542|ref|YP_001655815.1| 449447.MAE_08010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]