SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I6V474 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6V474
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.22e-47
Family GHMP Kinase, N-terminal domain 0.0000847
Further Details:      
 
Domain Number 2 Region: 183-329
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.58e-37
Family Mevalonate kinase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I6V474
Sequence length 334
Comment (tr|I6V474|I6V474_9EURY) Mevalonate kinase {ECO:0000256|HAMAP-Rule:MF_00217} KW=Complete proteome OX=1185654 OS=Pyrococcus furiosus COM1. GN=PFC_10420 OC=Pyrococcus.
Sequence
MKVIASAPAKVILFGEHSVVYGKPAIAAAIDLRTFVEAELIREKKIRIEAHDIKVPGLTV
SFSENEIYFETDYGKAAEVLSYVREAINLVLEEADKKNVGIKVSITSQIPVGAGLGSSAA
VAVATIGAVSKLLGLELSKEEIAKMGHKTELLVQGASSGIDPTVSAIGGFIFYEKGKFEH
LPFMELPIVVGYTGSSGPTKELVAMVRKRYEEMPELIVPILEAMGKVVEKAKDVILSNVD
KEEKFERLGVLMNINHGLLDALGVSTKKLSELVYAARVAGALGAKITGAGGGGCMYALAP
NKQREVATAIRIAGGTPMITEISREGLKIEEVIK
Download sequence
Identical sequences I6V474 Q8U0F3
Pfu-1528186-001 gi|397652714|ref|YP_006493295.1| gi|18978009|ref|NP_579366.1| 186497.PF1637 WP_011012784.1.13913 WP_011012784.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]