SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7G6U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7G6U7
Domain Number 1 Region: 716-918
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.05e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 2 Region: 434-620
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000188
Family Pyruvate oxidase and decarboxylase PP module 0.073
Further Details:      
 
Domain Number 3 Region: 22-207
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000212
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.089
Further Details:      
 
Domain Number 4 Region: 281-394
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000561
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7G6U7
Sequence length 1161
Comment (tr|I7G6U7|I7G6U7_MYCS2) Pyruvate ferredoxin/flavodoxin oxidoreductase {ECO:0000313|EMBL:AFP41417.1} KW=Complete proteome OX=246196 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155). GN=MSMEI_4973 OC=Mycobacterium.
Sequence
MTELHSREFALTDRYTLADGEVFLTGLQALVRIPFEQSRRDSADGQRVGILISGYEGSPL
AGYDLELGRQRELLDSHSVVFQPGLNEELAANAVQGSQLASASPSCEYDGVVGIWYGKAP
GLDRATDALRHANLGGADAKGGALVLVGDDSIAKSSTVPSGSEAAMAELGLPVLVPSDPQ
EVLDFGLHGIAMSRFSGLWVGMKLATNVVDGSATVRFDRSRVTVQSPDREIDGAEFRHTV
SAHFVQPTLGNLERSMFGERLELARRYVAANDLNRTVGDPDAKLGIITAGTGFRDTVQAL
QRLGIAETDLVHSGIRILKLGVINPLDQRHVQEFSEGLDEVVVVEEKRAFIELAVKDALY
GRASVPRVLGKRDEHGRRFLRADADLPPEILAEKLGQRIRKVLPANQIESVSSVERTPAG
RIELPLLTRTPYFCSGCPHNRSTVVPDGSLVGAGIGCHAIATMMPHERVGEIVSLCQMGG
EGAPWIGMAPFVSENHLFQNLGDGTFHHSGSLAIRAAVASGVNITYKLLYNDAVAMTGGQ
RAVGKMSVPQIVQELLAEGVARIVVTTDDVKKYRKVSLPHGVAVLDRSELMSVQEELART
AGVTVLIHDQECATELRRKRKRGLAPEPVTRAFINERLCEGCGDCGQKSNCMSVQPVDTE
FGRKTRIDQASCNKDYSCLDGDCPSFVAVRPGRTESSETSATAPIPDPTPIVGTDAFNVR
ITGVGGTGVVTTSQIVATAGTLAGFHVRGLDQLGLAQKGGAVVSDLKFSTRPITGTNKLA
AGECDLYLGCDLLVAADAKNLAVASNSRTVAVISTSQVPTGSMILKPSTAFPASAEVRER
LDPSTRAHDSLYADARALAYREFGSDQLANMILVGMAVQVGSLPIPLSALEKAVELNGVA
VSANLRALHVGRAYVHDPQPVNALKGVYTNHVRVARRVRRAVHELRGVDEGFRDRLGFLA
ADLVAYQNQSYALQFVNFVADTAELERHAVGSVGPLTVTAAESMYKLMAYKDEYETARLF
LDPGFEQSVRETFGDDASFAYKLHPPMLRAMGLDHKLTLGAWFKPALYALRTARRVRGTR
LDVFGYAHVRQVERSLVDDYAKLTREVVPRATQGNIDAIREILGLAQEVRGYESIKMANV
ESYRRKVAAALDALSATAAVG
Download sequence
Identical sequences A0R2G2 I7G6U7
gi|118470996|ref|YP_889350.1| WP_011730314.1.100356 WP_011730314.1.19768 WP_011730314.1.23286 WP_011730314.1.56412 WP_011730314.1.74845 YP_889350.1.77314 246196.MSMEG_5100 gi|118470996|ref|YP_889350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]