SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7IAC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7IAC1
Domain Number 1 Region: 3-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-104
Family AAT-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7IAC1
Sequence length 397
Comment (tr|I7IAC1|I7IAC1_9RICK) Aminotransferase {ECO:0000256|RuleBase:RU000481} KW=Complete proteome; Reference proteome OX=100901 OS=Wolbachia endosymbiont of Onchocerca ochengi. GN=wOo_04400 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
MLELAKRMSLIKLSPTIAVTDKVNRLKSQGKEICVLAAGEPDFDTPGHIKKAAIQAINEG
KTKYTAVDGTRELKGAIIDKLKRDNDLEYTPSQICVGAGAKQVLFNLLMATINPEDEAVI
PAPCWVSYVDMVSFFGGLPVMAECKENFKLTSELLRSKITEKTKWLILNSPNNPAGVVYT
YDELKKIAQILLEHPHVNIITDDIYEHIVYDGKFFTIAQVEPRLYDRVFVVNGVSKAYAM
TGWRIGYVAGRSDVVKAISILQSQSTSNPNSIAQAAAVEALNGNHDFLKERIKIFKNRRD
FVAEKLGSVPGLSVFIPQGAFYLFISCENLLGKSTKNGKVINNDLDFAEYLLEDHLVAVI
PGVAFSLKNFIRVSYATSQEQLEIGCNSIVKACEMLS
Download sequence
Identical sequences I7IAC1
WP_014868919.1.68585 gi|402496691|ref|YP_006555951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]