SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7J866 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7J866
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.11e-24
Family Hypothetical protein PH1932 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7J866
Sequence length 180
Comment (tr|I7J866|I7J866_METBM) Transcriptional regulator, ArsR family {ECO:0000313|EMBL:CCJ35923.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_1000 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MEPVDIVLTKDTFEVLASETRLDILKTLSTRRMTVTELADTLDLAKSTVHHHLQRLADAG
LVAADDDGRAWVYYALTQEGQGLLQPHDGTRIRVLLAAGLASLVGGVCAVVAFLTAPVRE
GPVSPRPGGGGLPVPAGPPVELLVAGIALAVIGGILVAYACIRWRNRRATEDFCAGEEVT
Download sequence
Identical sequences I7J866
WP_014866899.1.51038 gi|397780166|ref|YP_006544639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]