SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7KB41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7KB41
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.08e-53
Family Rps19E-like 0.0000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7KB41
Sequence length 149
Comment (tr|I7KB41|I7KB41_METBM) 30S ribosomal protein S19e {ECO:0000256|HAMAP-Rule:MF_01474} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_0293 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MTTVYDIPADILIRQVAEELKKNPQIQPPDWAAFAKTGVHKEMPPENDDWWYVRAASVFR
RVYIDGPVGTQKMRSIYGGKRNRGSAPGQFRRGSGSIIRKVLQQLEAAGYVSHTSEGRTV
TAAGRSFLDNVAHGLKAEAAGTAPGLAKY
Download sequence
Identical sequences A0A0X3BI67 A0A167S200 I7KB41
WP_014866193.1.51038 WP_014866193.1.63524 WP_014866193.1.88179 gi|397779459|ref|YP_006543932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]