SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7KDF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7KDF5
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000214
Family Iron-dependent repressor protein 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7KDF5
Sequence length 92
Comment (tr|I7KDF5|I7KDF5_METBM) Uncharacterized protein {ECO:0000313|EMBL:CCJ36781.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_1858 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MREEDLDWAVYHQIPENGGVTTGDLVAATGFEPSAVTASLERLERYLLIRRSGETVRLLS
VQESLVECRCRYTVDLPFVIENGVIKAKRRDE
Download sequence
Identical sequences A0A0X3BN35 A0A167SY56 I7KDF5
gi|397781024|ref|YP_006545497.1| WP_014867754.1.51038 WP_014867754.1.63524 WP_014867754.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]