SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7LNS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7LNS7
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.09e-29
Family HxlR-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7LNS7
Sequence length 130
Comment (tr|I7LNS7|I7LNS7_METBM) Transcriptional regulator, HxlR family {ECO:0000313|EMBL:CCJ37364.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_2441 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MEKDSDRICLCPLEGIITTIAKKWAILIISILGHHERLRFNDIMEILGGISPKSLTDTLK
ELQREGLIQREAFPEIPPRVEYSLTEDGRQLCEAIVPLVRWAEKRDNLPAKTCHATCGFS
EGCPSRREGR
Download sequence
Identical sequences I7LNS7
WP_014868335.1.51038 gi|397781607|ref|YP_006546080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]