SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J1NXN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J1NXN1
Domain Number - Region: 65-203
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J1NXN1
Sequence length 438
Comment (tr|J1NXN1|J1NXN1_STREE) Uncharacterized protein {ECO:0000313|EMBL:EJG44337.1} KW=Complete proteome OX=914141 OS=Streptococcus pneumoniae 2070335. GN=AMCSP13_001485 OC=Streptococcus.
Sequence
MRITDNQHKIIKEKFVEEYPKLSNLLLDRTLESLSQDERIFIFPNDLTHTPDLDKDQKIF
ETVNQKIKTGNVIGFLGYGQERLTISSRFSDESNDHFLHYLLNKVLYINLTSLDVALSRE
ERLYQLLMYLFPKYLQAAIRKGLYKEYHRFFHNDSHVKGVIDVRSHLKKNLPFTGNIAYA
TREFTYDNPLMQLVRHTIEYIKNQKSIGQGVLDNLSTSRENVSEIVRVTPSYKLADRAKI
TRGNQSKPIRHAYFHEYRNLQELCLMILNQEKHGLGYQDQKIYGILFDVAWLWEEYVYTL
LPKGFVHPRNKDKTDGISVFSVGKRKVYPDFYDRERKIVLDAKYKKLELTEKGINREDLF
QLISYSYILKAEKAGLIFPSMEQSVNSEIGKVAGYGAQLKKWSIRIPQNASSYSAFCKMM
ENSEENFKAIIDEEVGRK
Download sequence
Identical sequences J1NXN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]