SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J3KN59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3KN59
Domain Number 1 Region: 266-433
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-18
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J3KN59
Sequence length 435
Comment (tr|J3KN59|J3KN59_HUMAN) BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 {ECO:0000313|Ensembl:ENSP00000267859} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BNIP2 OC=Catarrhini; Hominidae; Homo.
Sequence
MLCGFQEDATPPPPPRPRRLHRRLPRPEEVGMLSLPPGLLTVSGSAAAADAVPLRPGDWA
GVSTADRGERAPLGPAFCDLAVSPTSPAWRGEEDEGAKASSGDIGSLDYQEFVVDIESRL
RMEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDIS
LTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYT
AAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESS
QPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRK
NLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQV
DQELNGKQDEPKNEQ
Download sequence
Identical sequences J3KN59
ENSP00000267859 ENSP00000479818 ENSP00000267859 ENSP00000267859 gi|168480080|ref|NP_004321.2| NP_004321.2.87134 NP_004321.2.92137 9606.ENSP00000267859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]