SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J3KRK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3KRK5
Domain Number 1 Region: 11-82
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.19e-21
Family GABA-aminotransferase-like 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J3KRK5
Sequence length 128
Comment (tr|J3KRK5|J3KRK5_HUMAN) Serine hydroxymethyltransferase, cytosolic {ECO:0000313|Ensembl:ENSP00000462043} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SHMT1 OC=Catarrhini; Hominidae; Homo.
Sequence
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRLPCKLCCVHCPGGTPWAHHGPGPSGWGPPDPWVHDRQEE
NLCHVHLL
Download sequence
Identical sequences J3KRK5
ENSP00000462043 ENSP00000462043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]