SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J3MPI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3MPI2
Domain Number 1 Region: 254-343
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-16
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3MPI2
Sequence length 364
Comment (tr|J3MPI2|J3MPI2_ORYBR) Uncharacterized protein {ECO:0000313|EnsemblPlants:OB08G10110.1} KW=Complete proteome; Reference proteome OX=4533 OS=Oryza brachyantha (malo sina). GN=102704633 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MGQMDGGGDGGGYPYHYQALLAAVHQQTVPFPNPFPAPSSGTEAPLHNHSHNHNHNHNHN
HNHNHNHNHNHNHNHNHNAAPHPHTPTPRGFADWSASTSAFTSLAAHSSPAPSNAVHYSF
SPCYAFWAHYMVNKNAYPSFPAPHEEPPHQLRLANSHPRDASGPASSFGVESFNSASMAP
NICNHMPPIEGPISANEDKKPEILPRVIKSSDELETRNSGVELHCETVGALPESKQSHES
RATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPMILHMDDMVLP
VTWKFKYRYWPNNKSRMYILDSAGEFLKTHGLQAGDVIIIYKNLASGKFMIRGEKAIHQQ
TTNS
Download sequence
Identical sequences J3MPI2
OB08G10110.1 XP_006659013.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]