SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J3WM70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3WM70
Domain Number 1 Region: 9-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-84
Family Protein kinases, catalytic subunit 0.00000338
Further Details:      
 
Weak hits

Sequence:  J3WM70
Domain Number - Region: 430-488
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000113
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 506-566
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 364-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J3WM70
Sequence length 671
Comment (tr|J3WM70|J3WM70_LACHE) Kinase domain protein {ECO:0000313|EMBL:AFR21796.1} KW=Complete proteome OX=880633 OS=Lactobacillus helveticus R0052. GN=R0052_04480 OC=Lactobacillus.
Sequence
MIDKGYLLGERYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQNEPQTQARFKRE
ALATSELSHPNIVSVLDVGTDHGLHYMVMEYVDGPDLKEYIRQNAPLDLHEVIRIMDKIL
SAVALAHKHNVIHRDLKPQNILMDKRGNIKIADFGIAVALNQSSVTQTNSVMGSVHYMSP
EQTRGGLVTKQSDIYSLGIILYELITGTVPFNGDTPVSIALKHAQEPIPSIRKKDHSVPQ
ALENVVLKATAKDPRDRYATAQAMQADLDSSLDPERADEPVFVPNHGNNNDKTIVLPGFK
APEKEQPTESDEETKPDKKEKKKDFWQNVKSHKWWWIFSIIATGLIIFIMIFALSGSNNK
PHQVHIPDVTNITEKSAEKKLEAAGLQIGKVVKRQSDDIKKGHVIGTKPAAGNSMDQGKA
IILIVSSGSSMVKVPNVVGDNYYEAAEKLENQGFDVVREDQYSNKVARDNIISQSIAAGV
EVKPTQTTITLVVSRGKQVKPKINTVTLKDLHNYSLKSAQDYAKEHGLTLQINQEYSDEV
EKGLVISMQPKAGTKVERGSTVTIKVSRGPKEEKDTTITKTFTVNYIGTDLNKDDKSDSK
SGDASNKEDSSKGDHVQIYIKDDDHSLSNIYRDLYIKRDMSFSIPFSLKNGNGQLRVVRN
RETVLNEKVTK
Download sequence
Identical sequences J3WM70
gi|403514780|ref|YP_006655600.1| WP_014918587.1.21552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]