SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J6EMP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J6EMP8
Domain Number 1 Region: 5-212
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.09e-32
Family Ran-binding protein mog1p 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J6EMP8
Sequence length 215
Comment (tr|J6EMP8|J6EMP8_TRIAS) Uncharacterized protein {ECO:0000313|EMBL:EJT45579.1} KW=Complete proteome OX=1186058 OS=2466 / KCTC 7840 / NCYC 2677 / UAMH 7654) (Yeast). GN=A1Q1_06025 OC=Tremellomycetes; Trichosporonales; Trichosporonaceae; Trichosporon.
Sequence
MADVQTTTRPLFGGAISFDVPKDYIDASDLRQVPDNQEVFLSNDSDTAIIFEILGAVQDG
GAASDMYEAANVAHDNAALSATLTTPPPPTHVVPAQTQHVQSASELQTPHPTVVTGIQKV
HKFSHDPSGAPRRGHENDAPDEVWIGLALWRIDVDIAGHKKKADIVCTANVPLKEAAEGN
PNGVTSEELAKVEGWWRNAVAGMKINDWNLFGDEN
Download sequence
Identical sequences J6EMP8 K1VH97
XP_014176709.1.42847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]