SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J8C373 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J8C373
Domain Number 1 Region: 61-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.48e-61
Family L-arabinose binding protein-like 0.0000501
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.98e-18
Family GalR/LacI-like bacterial regulator 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J8C373
Sequence length 325
Comment (tr|J8C373|J8C373_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EJQ67351.1} KW=Complete proteome OX=1053203 OS=Bacillus cereus HuA2-4. GN=IG7_03987 OC=Bacillus cereus group.
Sequence
MANIKQIAKTAGVSISTVSRVLNNHPYVKEEKRKRVLDAVEELNYAKNINAIHLIKGKTY
TIGVMLPFINLPYFSTIIEGIGNEALAAGYHINLCQTNYDSIEEIRVLEMMKMKQFDGMI
ICSRTSSWEQIEPFAKFAPIISCEKMKHPLISSVYVDHYEGFRLGTSYLLSKGHEKIGIC
LARKTSANSIEREKAFADTLRQEGKTVHPDWVFHQCYTMQDGAKILHRILNMKNRPTAIF
TANDQVAAGLLTEAKKHGIRIPEDLAILGFDNHEISKALEITTIEHPGLTMGSRAFSLFH
KQIQNEHIIGNSEELSFHLIERKTV
Download sequence
Identical sequences A0A2A7ZEL9 A9VGZ6 J8C373
315730.BcerKBAB4_4066 WP_002143116.1.85012 WP_002143116.1.99908 gi|163941972|ref|YP_001646856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]