SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J8CNC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J8CNC3
Domain Number - Region: 3-157
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00942
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J8CNC3
Sequence length 159
Comment (tr|J8CNC3|J8CNC3_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EJQ68797.1} KW=Complete proteome OX=1053203 OS=Bacillus cereus HuA2-4. GN=IG7_03142 OC=Bacillus cereus group.
Sequence
MKNYTIEEKDSFIVLGIGTELKSHYTDFAGINKEKADFWLAVEQDGRLDTLKALATNDYI
FSVSEAVNNKMMYYAGVMTEATIQEESRVIQFPRGEYLVVKGEGDTAEELSNKLTGIAFG
QALAEVKDFSYVGGPNTTVEMGQRNGLVFGEIWIPVVRK
Download sequence
Identical sequences A0A0A0WJ20 A0A150BVX1 A9VMP7 C2SMV5 J8CNC3
gi|163941064|ref|YP_001645948.1| WP_002033380.1.30061 WP_002033380.1.31050 WP_002033380.1.4496 WP_002033380.1.54007 WP_002033380.1.57105 WP_002033380.1.85012 WP_002033380.1.99908 315730.BcerKBAB4_3144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]