SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J8NNP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J8NNP7
Domain Number 1 Region: 113-329
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.06e-61
Family D-glucarate dehydratase-like 0.00000518
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.84e-28
Family Enolase N-terminal domain-like 0.0000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J8NNP7
Sequence length 350
Comment (tr|J8NNP7|J8NNP7_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EJS07298.1} KW=Complete proteome OX=1053248 OS=Bacillus cereus VDM034. GN=IKO_02204 OC=Bacillus cereus group.
Sequence
MKITDVKVNRRHVKLHTPFKTALRTVTEIESIDVFIHTDEGIVGKGAAAATPVITGDFAN
GIEEAILGPIRSVLVDKDVLQFQTLLLHIQMSCIGNTSAKAAVDMALYDVYCRFHNIPLY
ALLGGKKEIHTDITVSVDEPLLMAKEAKKHIEKGFQTLKIKVGKEAHLDLERIEAIRNVV
PKNTTLRLDANQGWKPKEAVSIIREMENRNLNIEFVEQPVHAKDWEGLKYVKDNVQTPIM
ADESMFSASDALKIVQGGYADLLNIKLMKCGGIREAWKIADIAEAAGVKCMVGSMMEPSL
SVSAVAHLAAAHPNIHYFDLDAPLWLVEEPEGMTYTGPKVNLHSIVNIQS
Download sequence
Identical sequences A0A0A0WKU1 A0A243A8A2 A9VIJ4 J7WVD6 J8NNP7 J8PL33
WP_002085027.1.10033 WP_002085027.1.30061 WP_002085027.1.31050 WP_002085027.1.4496 WP_002085027.1.46157 WP_002085027.1.47674 WP_002085027.1.52845 WP_002085027.1.57105 WP_002085027.1.64566 WP_002085027.1.93582 WP_002085027.1.99908 315730.BcerKBAB4_2652 gi|163940598|ref|YP_001645482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]