SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J8V0H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J8V0H9
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.63e-28
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J8V0H9
Sequence length 181
Comment (tr|J8V0H9|J8V0H9_PSEPU) Cytochrome B561 {ECO:0000313|EMBL:EJT83229.1} KW=Complete proteome; Reference proteome OX=1218169 OS=Pseudomonas putida S11. GN=PPS11_37235 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MVSSTPATHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSVERNLMKDLHFMLGLSVF
VLVWLRLAIRLSRPTPPIVPKPAAWQTGLAHLMHLALYLLMIILPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences A0A0P7CVV3 A0A136QMA0 A0A2A3M6U7 J8V0H9 L0FI97
WP_003260150.1.32670 WP_003260150.1.41505 WP_003260150.1.57632 WP_003260150.1.61620 WP_003260150.1.71677 WP_003260150.1.92076 WP_003260150.1.9402 WP_003260150.1.95946 WP_003260150.1.99927 gi|431801501|ref|YP_007228404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]