SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J8VAG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J8VAG2
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.7e-27
Family Clp protease, ClpP subunit 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J8VAG2
Sequence length 183
Comment (tr|J8VAG2|J8VAG2_PSEPU) Putative Clp protease {ECO:0000313|EMBL:EJT83830.1} KW=Complete proteome; Reference proteome OX=1218169 OS=Pseudomonas putida S11. GN=PPS11_29826 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MARHIVHFTGPINSSTCGNLINTCSRALQQGADVLQLNIATMGGECSYGFTLYNFLRALP
VEVHTHNLGTVESMGNIIFLAGERRTACSYSKFLFHPFHWTLHGSVDHSRMAEYAMSLDY
DLRLYAQIVAERTEGADEVLDVPRYLMAYPRILGPREALANGMIHAIDEMPIEAEACQWS
VHA
Download sequence
Identical sequences A0A1S2JQV1 J8VAG2 V9UY96
WP_003259457.1.1643 WP_003259457.1.23948 WP_003259457.1.28354 WP_003259457.1.56258 WP_003259457.1.65739 WP_003259457.1.7288 gi|568187642|ref|YP_008960249.1| gi|568182264|ref|YP_008954881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]