SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9AD89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9AD89
Domain Number 1 Region: 79-149
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.83e-22
Family Cyanase C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.98e-16
Family Cyanase N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9AD89
Sequence length 149
Comment (tr|J9AD89|J9AD89_BACCE) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome OX=1053193 OS=Bacillus cereus BAG6O-2. GN=IEM_02571 OC=Bacillus cereus group.
Sequence
MNRQEATQKIMEAKIAKGLTWEEISKVSENSETWVVTALLGQATMTRPEAEKIGKLLELD
EEVVQALTVVPLRGQVMQMPPTDPILYRLYEMMLQYAPTLRELILEKAGEGVMSAINFNL
GVDTQEDPKGGDPRIVITLNGKFLPFRTW
Download sequence
Identical sequences A0A084ISF7 A0A0A3VL74 A0A1I6BRX1 A0A1X3ML85 A0A242X3I0 A0A243A910 A0A243FWW5 A0A2C9YRZ1 A9VQ33 C2Q342 C2SSG5 C2V2U4 C2XL56 C2Y1H6 J7W835 J7Z7E7 J8D462 J8HKJ9 J8J6S5 J8K6L9 J8KVE1 J8LCG8 J8NIU0 J8PZI3 J8Y6J0 J9AD89 K0FWM0 R8CPA2 R8CRM7 R8DLN7 R8EGA8 R8F370 R8FDD5 R8GNA0 R8HJG8 R8JVL6 R8L6F6 R8MGY0 W4ENM1
gi|407707588|ref|YP_006831173.1| WP_001081567.1.100095 WP_001081567.1.10033 WP_001081567.1.100646 WP_001081567.1.100649 WP_001081567.1.10584 WP_001081567.1.10688 WP_001081567.1.10775 WP_001081567.1.11324 WP_001081567.1.11380 WP_001081567.1.13113 WP_001081567.1.17940 WP_001081567.1.20051 WP_001081567.1.20881 WP_001081567.1.21695 WP_001081567.1.22152 WP_001081567.1.23136 WP_001081567.1.23181 WP_001081567.1.27138 WP_001081567.1.27729 WP_001081567.1.27732 WP_001081567.1.28299 WP_001081567.1.2902 WP_001081567.1.2904 WP_001081567.1.30061 WP_001081567.1.31050 WP_001081567.1.31221 WP_001081567.1.35095 WP_001081567.1.36226 WP_001081567.1.37626 WP_001081567.1.37635 WP_001081567.1.37801 WP_001081567.1.38645 WP_001081567.1.39255 WP_001081567.1.39317 WP_001081567.1.39896 WP_001081567.1.42182 WP_001081567.1.42272 WP_001081567.1.42747 WP_001081567.1.4354 WP_001081567.1.43914 WP_001081567.1.4496 WP_001081567.1.45835 WP_001081567.1.46157 WP_001081567.1.47674 WP_001081567.1.47957 WP_001081567.1.50411 WP_001081567.1.50487 WP_001081567.1.52532 WP_001081567.1.52845 WP_001081567.1.53916 WP_001081567.1.54007 WP_001081567.1.55077 WP_001081567.1.57105 WP_001081567.1.59016 WP_001081567.1.60012 WP_001081567.1.60236 WP_001081567.1.60255 WP_001081567.1.63476 WP_001081567.1.6426 WP_001081567.1.64566 WP_001081567.1.68186 WP_001081567.1.68668 WP_001081567.1.71142 WP_001081567.1.72824 WP_001081567.1.72867 WP_001081567.1.73790 WP_001081567.1.75292 WP_001081567.1.75300 WP_001081567.1.76817 WP_001081567.1.79293 WP_001081567.1.79549 WP_001081567.1.82832 WP_001081567.1.8290 WP_001081567.1.83206 WP_001081567.1.84520 WP_001081567.1.85012 WP_001081567.1.85187 WP_001081567.1.85667 WP_001081567.1.86374 WP_001081567.1.86789 WP_001081567.1.87416 WP_001081567.1.87947 WP_001081567.1.89263 WP_001081567.1.89718 WP_001081567.1.89932 WP_001081567.1.90466 WP_001081567.1.92586 WP_001081567.1.93582 WP_001081567.1.94308 WP_001081567.1.94914 WP_001081567.1.97327 WP_001081567.1.98053 WP_001081567.1.99558 WP_001081567.1.99908 gi|163942804|ref|YP_001647688.1| 315730.BcerKBAB4_4912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]