SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9YXK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9YXK1
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.1e-34
Family Methylenetetrahydrofolate reductase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9YXK1
Sequence length 242
Comment (tr|J9YXK1|J9YXK1_9PROT) Uncharacterized protein {ECO:0000313|EMBL:AFS47661.1} KW=Complete proteome OX=859653 OS=alpha proteobacterium HIMB5. GN=HIMB5_00009090 OC=Pelagibacteraceae.
Sequence
MNFSLEIGPHTDLSTLPAVKDVYVTLLPGGDYKETAKKSGDLVKEGFNPVPHVPARSISN
DEELKDYMNMCKDLGVKQALVIGGSREPIGKFDSSFQILETGYLEGIKIGIAGHPEGSPD
ISDQDLEKAMIDKKPYADYIVTQWLLDTQPIIDFISKQSVPVHVGITGPMKISSLIKFAN
IVGAKNSINFLKSNFSKALDLLKPKDPNDLIGKVKSHTDNFHIYTFGGLKETNKWLKENK
YV
Download sequence
Identical sequences J9YXK1
WP_014953492.1.76190 gi|406706485|ref|YP_006756838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]