SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0BDY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K0BDY9
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily GlnB-like 2.73e-16
Family Prokaryotic signal transducing protein 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K0BDY9
Sequence length 109
Comment (tr|K0BDY9|K0BDY9_9ARCH) Nitrogen regulatory protein P-II {ECO:0000313|EMBL:AFS83679.1} KW=Complete proteome OX=1229909 OS=Candidatus Nitrosopumilus sediminis. GN=NSED_09445 OC=Nitrosopumilus.
Sequence
MLKIEVILGENDVMAISEGLKAVGIGGLTVSKVRGRGKKPGPEIHASKGSEIFVPQFNDK
YRLEVIISDTKEDEVVSIIKENARVGKIFISQILRAIDISTDAEGEKTI
Download sequence
Identical sequences K0BDY9
WP_014966043.1.40567 WP_014966043.1.82955 gi|407465739|ref|YP_006776621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]