SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K0D9P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K0D9P9
Domain Number 1 Region: 148-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-22
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K0D9P9
Sequence length 253
Comment (tr|K0D9P9|K0D9P9_MAIZE) ABI48 ABI3VP1 type transcription factor {ECO:0000313|EMBL:AFT82674.1} OX=381124 OS=Zea mays subsp. mays (maize). GN= OC=Zea.
Sequence
MAEAVAVAYEEQRRRQIEMNKRKLEELQLHHLSAAVREAAAAAKPSSAKKRKAPVPRDAA
TEPPRRSDRLANLPEKPMYREVRVNLPFPEGSKSNARVPLDAANSVVVEPLRWSDRLANL
PKKPMYHEDSDEERSYAISKAEELVQELGSSFPIFTQPMTLSHVSGGFWLGLPKHFCREH
LPKSDETITLVDEEDDESDTFYLAMQAGLSTGWKEFAIQHKLLDGDCLVFQLIERTKFKV
YIIRATLYFESDH
Download sequence
Identical sequences B4FXE4 K0D9P9
GRMZM2G111123_T01|PACid:20829363 GRMZM2G111123_T02|PACid:20829364 GRMZM2G111123_P01 GRMZM2G111123_P02 NP_001141649.1.34533 XP_008672457.1.34533 XP_008672458.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]