SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K0MA12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K0MA12
Domain Number 1 Region: 86-218
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.92e-28
Family GntR ligand-binding domain-like 0.008
Further Details:      
 
Domain Number 2 Region: 16-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000169
Family GntR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K0MA12
Sequence length 240
Comment (tr|K0MA12|K0MA12_BORPB) Probable GntR-family transcriptional regulator {ECO:0000313|EMBL:CCJ47668.1} KW=Complete proteome OX=1208660 OS=Bordetella parapertussis (strain Bpp5). GN=BN117_0335 OC=Alcaligenaceae; Bordetella.
Sequence
MTTTMYKTTTEPAEKGRRAFSQVLEKLREMVISYEIKPGERLNEVALAERLGVSRTPVRE
ALHFLARDGFLAEAGRGYVRRPLNLKEMIDLYETREVLEVACLQLAAGRATPQRLDALEA
FLAESRAKSPDLPVTELVSLDETFHHMLAEMSGNHELQRILHNVNERIRFIRWINMERIG
RDKTQAEHAAILAALRAGDIGTAQQNLRSHISKRTEQIKECIAQGLARIYLDDDETSPGA
Download sequence
Identical sequences A0A0H3LP59 A0A2J9U3H5 K0MA12 Q7WCI5
gi|33599330|ref|NP_886890.1| gi|33595050|ref|NP_882693.1| gi|410471126|ref|YP_006894407.1| WP_010925773.1.15674 WP_010925773.1.1660 WP_010925773.1.21837 WP_010925773.1.23657 WP_010925773.1.24339 WP_010925773.1.26498 WP_010925773.1.29688 WP_010925773.1.37794 WP_010925773.1.40806 WP_010925773.1.50287 WP_010925773.1.58338 WP_010925773.1.63299 WP_010925773.1.63717 WP_010925773.1.69310 WP_010925773.1.71104 WP_010925773.1.71382 WP_010925773.1.72302 WP_010925773.1.82663 WP_010925773.1.84976 WP_010925773.1.86585 WP_010925773.1.87218 WP_010925773.1.91389 YP_006894407.1.34978 257310.BB0341 257311.BPP0338 APC84143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]