SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1A4P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1A4P1
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.09e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K1A4P1
Sequence length 105
Comment (tr|K1A4P1|K1A4P1_9STRE) PTS system, lactose-specific IIA component {ECO:0000313|EMBL:EKA06133.1} KW=Complete proteome OX=1169675 OS=Streptococcus sp. GMD6S. GN=GMD6S_05777 OC=Streptococcus.
Sequence
MNREEVTLLGFEIVAYAGDARSKLLEALKAAEAGDFAKADSLVEEAGGCIAEAHHAQTSL
LTKEAAGEDLAYSVTMMHGQDHLMTTILLKDLMHHLIELYKRGVK
Download sequence
Identical sequences A0A0F2E183 A0A139PQI5 A0A1H0QAK6 A0A1X1GPS4 A0A1X1J7T6 E6KMC1 F2QDM4 F9P0D6 I0Q9F2 K1A4P1
gi|331266453|ref|YP_004326083.1| WP_001078319.1.100219 WP_001078319.1.100485 WP_001078319.1.1053 WP_001078319.1.14100 WP_001078319.1.22905 WP_001078319.1.28799 WP_001078319.1.29838 WP_001078319.1.35113 WP_001078319.1.38031 WP_001078319.1.39131 WP_001078319.1.39374 WP_001078319.1.40598 WP_001078319.1.47273 WP_001078319.1.49758 WP_001078319.1.50241 WP_001078319.1.53598 WP_001078319.1.58011 WP_001078319.1.63103 WP_001078319.1.6490 WP_001078319.1.66872 WP_001078319.1.7183 WP_001078319.1.75977 WP_001078319.1.78044 WP_001078319.1.79719 WP_001078319.1.8597 WP_001078319.1.93306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]