SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1VF91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1VF91
Domain Number 1 Region: 4-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-72
Family Capz beta-1 subunit 0.000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1VF91
Sequence length 282
Comment (tr|K1VF91|K1VF91_TRIAC) F-actin capping protein beta subunit {ECO:0000313|EMBL:EKD02700.1} KW=Complete proteome; Reference proteome OX=1220162 OS=Trichosporon asahii var. asahii (strain CBS 8904) (Yeast). GN=A1Q2_02930 OC=Tremellomycetes; Trichosporonales; Trichosporonaceae; Trichosporon.
Sequence
MAEDTLLDLLRRLPPTRAEANIEALCQLAPEYADDLLGNVDQPLKVLHDEQSGKDFLGCD
YNRDGDSFRSPWTDEYIPPAPGAPQPSPRLRQLEVSLNTAFETYREMYFEGGTSSVYLWD
LDEDPATAKDMQFAGVVLMKKTLPSGPSSGSWDSLHVFECAERGRQAKYKLTSTVMLVLE
ARTSSPEDAKLAAQGEGNVTLSGSMTRQAATDCALPNATAHIGNIGRMVEDMEIKMRNLL
SSVYFGKTKDVVGELRSLSGLEAKSKEDLLRQELASKLGGMR
Download sequence
Identical sequences J4UJ45 K1VF91
XP_014182735.1.42847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]