SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3XRB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3XRB9
Domain Number - Region: 1-54
Classification Level Classification E-value
Superfamily F-box domain 0.000157
Family F-box domain 0.0082
Further Details:      
 
Domain Number - Region: 105-209
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00772
Family Tricorn protease domain 2 0.044
Further Details:      
 
Domain Number - Region: 191-269
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 0.0209
Family Pyruvate phosphate dikinase, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3XRB9
Sequence length 313
Comment (tr|K3XRB9|K3XRB9_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL07644.1, ECO:0000313|EnsemblPlants:Si004460m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_004460mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
PWASLPQDLLELIAWRVLAGDLLDYVRFRSVCSHWNSSTVPPRGRGLVDPRFHPRRWMLF
PEGYGLYPGHPNLGGVCAAVTVNAAGAITVMLCLDTKRRVAYAATGDRRWSLSAWKLPRL
RAVTMSFQGKFYAMAVNSADKNNVYICRIDPPQPSAEGNHSLSLPPPRMLVKSPLDGGLM
VLGFTDVSLAHLVVYRVSDLTKGRVAPLTSIGEHAIFSEVHALCISAKRFPSILGNSIIC
KNRSSRMVETHDFNPLLGRRAVRPAHPLVEQYDLGSDTWSPAIDEDIVHSDRTPASPYTL
AHHIFTCCCRYYW
Download sequence
Identical sequences K3XRB9
Si004460m|PACid:19673484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]