SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3XRM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3XRM6
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily F-box domain 0.00133
Family F-box domain 0.01
Further Details:      
 
Domain Number - Region: 87-161
Classification Level Classification E-value
Superfamily RraA-like 0.00811
Family RraA-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3XRM6
Sequence length 315
Comment (tr|K3XRM6|K3XRM6_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL06251.1, ECO:0000313|EnsemblPlants:Si004570m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_004570mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MNWAGLHADILESISARLTEPKDFISFRAVCPQWRETITRTAHARFLPWILKSDEVGVSV
NVLFYSLSSEKYQEIHVPALKGRRTRLAGFGAGHLIGIDVDDDLSAVLVNPLTGESTALP
RLPERFRGTITYGFAADHEMLREDDVSVAIYNWWPTGHVRIQVALWRRRGGHGWAVLPSE
RFWTRMPKQRSRLAAHGPEVLEGEIAGDGEEGEMEMQWVHDMDGAHLMEHGGQLRDKVIF
QSADTCCHVLPAGDNFVGLSKNSIYFLDRRRRRGDAEAYCLCKWDLLQRVATVVEEIPGD
WDWNLGRWFLPTLKY
Download sequence
Identical sequences K3XRM6
Si004570m|PACid:19678139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]