SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3XRY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3XRY7
Domain Number 1 Region: 8-64
Classification Level Classification E-value
Superfamily F-box domain 0.00000807
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3XRY7
Sequence length 167
Comment (tr|K3XRY7|K3XRY7_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL07293.1, ECO:0000313|EnsemblPlants:Si004683m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_004683mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
SPATSSPPESPRDYSALRRDALLDIFRRVPHADILRGAGLVRASWRRLAVAEPALWRHID
LSADEDKIVSPKYAPAQWQAMARAAVDRSAGQCQSFRGRADGDFLAYLADRSPALRSIHA
CHVSWIYMPRRGFIEGVIEKLPLLERLVMSRGYFHASAEVMRALLDH
Download sequence
Identical sequences K3XRY7
Si004683m|PACid:19674358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]