SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3XSD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3XSD8
Domain Number 1 Region: 106-282,346-382
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0000000889
Family Putative isomerase YbhE 0.04
Further Details:      
 
Domain Number 2 Region: 6-47
Classification Level Classification E-value
Superfamily F-box domain 0.00000458
Family F-box domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3XSD8
Sequence length 418
Comment (tr|K3XSD8|K3XSD8_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL03426.1, ECO:0000313|EnsemblPlants:Si004837m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_004837mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MAAPESDGIRPWADLPVEMVDAIVQQLDLFSTTRLASVCTSWSTAVATNAALPFGTPCLL
MTGEEEDDNGARGDDHEDWSYQLMNLTTERGDSFPALIRDVQEQWWVGGKDDWLAVVDRY
GGARLLNPYTGRQIDLPRTPAAVGPGVTNTGLGFDRIVVCATPSDDEGYLVIGMVNDYLL
AIARGRDDGWTELRNPDGHPAGGYKDAVVHKGKVFAVDKSGSIYAWDLQGGACPEPEKLE
PPHIDRGEFEHEGWKLAESADRRRLLLVWTYGKMVNCRRFKVYGCFDYLEFVAEGARLCE
RDVDAAAGLSDGDAGWSPVSSLGDHSLFLGANYPFFARVGNQGTSDSDSVWGMVRPNCIC
FAKGHLFQSQDVDVEVFDLDAEEYQYNPYKLILSNSRHYSSYQEPIWFRPTLKNYDLE
Download sequence
Identical sequences K3XSD8
Si004837m|PACid:19673513 XP_004971509.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]