SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3YCX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3YCX3
Domain Number 1 Region: 12-53
Classification Level Classification E-value
Superfamily F-box domain 0.00000000406
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3YCX3
Sequence length 153
Comment (tr|K3YCX3|K3YCX3_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQK97360.1, ECO:0000313|EnsemblPlants:Si012074m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_012074mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MPGASRSSILAGGDRLSSLPDCLLHHIMSFMKARQVVQTCVLSTRWEHLRTLPQHRPGGF
QDFTDHLIIPNNISLPLLDTFQLHISHRNCYQGKAAARWIHHGIKYNAQEPSIQRQGLSS
SSWRLERLSFPPCECTFHEITSHSLKNLILKDY
Download sequence
Identical sequences K3YCX3
Si012074m|PACid:19694643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]