SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3YZH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3YZH3
Domain Number - Region: 143-262
Classification Level Classification E-value
Superfamily L domain-like 0.000211
Family Ngr ectodomain-like 0.043
Further Details:      
 
Domain Number - Region: 21-55
Classification Level Classification E-value
Superfamily F-box domain 0.000458
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3YZH3
Sequence length 428
Comment (tr|K3YZH3|K3YZH3_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL30314.1, ECO:0000313|EnsemblPlants:Si019681m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_019681mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MDGRRSRKLDHETCSCRRLKDLIHRVISRLTVTEAGRTSVLSSRWRKRWTYHSNLCFDGT
CSELAGYGTDRFVAHVTTVLQHHSRLVVDRFELRSPLLGKEHAHHLDRWFDFAASTKARH
VALDLSPLHYEHRIVASPNKYRLPANQLAAPAGIVSLLLVNVCLELPPVSDGSRLLGFKA
LKKLELKFVVDLGDLTPFLASCPALEWLSISSSLIGHLVVPRQARCLRYLRLDCIGMHSI
HLDATSLTTFEYVGTSSIPIKTNHGLKLSQASIFIPWFFDGVSYFWDELSCWLAPVDRLL
LSLGMDAETRRFAKNPTEFIHLRHLTLFCHILRDPESPLVVLRLTQVLESAPQLEHLGLM
NSSDPVPFLSKAPDCSIHPHVHHHLKTVQMTGVIGLSGQLELAKYILLSATAVEYMTLSL
ATPRYRRV
Download sequence
Identical sequences K3YZH3
Si019681m|PACid:19689275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]