SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3YZM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3YZM1
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000628
Family F-box domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3YZM1
Sequence length 289
Comment (tr|K3YZM1|K3YZM1_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL32051.1, ECO:0000313|EnsemblPlants:Si019731m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_019731mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MEAAGTCEIARLPEELLSAALALTTPRDACRAAAVSRDFHASADSDAVWSRFLPRDPPPL
ADGELSGPAPPSEKGRFLRLCDRPVLLADGLMLTECCVQSMWLDRETGAKCYMLSARALR
ISWGDTPEYWRWMHPPESRFMEVAELQYVWWLEIRGMIHSKMLSQDSTYAAYIVFKTTDR
RDGLDYPPQEASITVAGSTSTHKVCLQSYDNEHEDGAVPLTWRYSRRHRRVFPGNLVIPQ
RRTDDWMELEMGQFYNKDGDDGEILGLEDVRIHFKFWQRKKRTYRICSH
Download sequence
Identical sequences K3YZM1
Si019731m|PACid:19686704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]