SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3YZY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K3YZY1
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily F-box domain 0.000392
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3YZY1
Sequence length 308
Comment (tr|K3YZY1|K3YZY1_SETIT) Uncharacterized protein {ECO:0000313|EnsemblPlants:Si019842m} OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN= OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MLVVTEDKWSQLPPELVHLICYKFPDTGNFICFRAVCTSWKHRGPRLQDRQHIQFYRHSS
GKMYYVRVGGRSSWFLGNGAFQGHVIAIVDLVKTMLYNPLTSKAQAIRPAPYQPWLDGVF
QVLGDGDAGSMVVNTCTITRHFAYYRPGVHAGWNIFDERKDIRHNTYNGGRFFDNMVDGN
TLVIDATTRDVMTIVLAPSRDKFSTTLGDYLVASHRKILRALQYPLDGSQATGCSSLITM
AMGEPNNAAGLMRDCIYFTHKKRMWVRLCNYRSLCRYNIKCGRVDKTISLASCDDPGQIF
RINLNPSP
Download sequence
Identical sequences K3YZY1
Si019842m|PACid:19690110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]